The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...
33 KB (4,074 words) - 15:18, 18 September 2024
Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R)...
6 KB (812 words) - 00:33, 10 March 2024
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...
2 KB (258 words) - 20:23, 20 December 2023
the action of GLP-1 is preserved in patients with type 2 diabetes. Glucagon-like peptide-1 receptor agonists gained approval as drugs to treat diabetes and...
26 KB (3,386 words) - 20:05, 10 September 2024
The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to...
12 KB (1,335 words) - 05:49, 17 August 2024
Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of anorectic drugs that reduce...
38 KB (3,935 words) - 21:33, 20 September 2024
glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide-1 receptor (GLP-1R) – binds Glucagon-like peptide-1...
367 bytes (75 words) - 20:07, 20 August 2024
Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...
24 KB (2,820 words) - 17:52, 15 September 2024
glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like...
2 KB (133 words) - 10:09, 17 January 2024
Semaglutide (category Peptide therapeutics)
type 2 diabetes and an anti-obesity medication used for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1)...
66 KB (5,428 words) - 08:55, 26 September 2024
natriuretic peptide (ANP) Calcitonin Cholecystokinin (CCK) Gastrin Ghrelin Glucagon Glucose-dependent insulinotropic polypeptide (GIP) Glucagon-like peptide-1 (GLP-1)...
5 KB (547 words) - 00:01, 22 August 2024
family peptide receptor 2 (RXFP2, GPR106) Relaxin/insulin-like family peptide receptor 3 (RXFP3, SALPR) Relaxin/insulin-like family peptide receptor 4 (RXFP4...
25 KB (2,172 words) - 01:01, 29 November 2023
Gastric inhibitory polypeptide (redirect from Gastrointestinal inhibitory peptide)
an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins...
9 KB (1,052 words) - 16:12, 2 May 2024
Tirzepatide (category Peptide hormones)
weight loss. Tirzepatide is a gastric inhibitory polypeptide receptor and glucagon-like peptide-1 agonist. The most common side effects include nausea, vomiting...
44 KB (3,493 words) - 05:47, 15 September 2024
Signaling peptide receptor is a type of receptor which binds one or more signaling peptides or signaling proteins. An example is the tropomyosin receptor kinase...
13 KB (706 words) - 20:05, 20 August 2024
recognized to be the principal physiologic action of GIP. Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after...
11 KB (1,186 words) - 21:23, 16 April 2024
amino acid residues that belongs to a glucagon/secretin superfamily, the ligand of class II G protein–coupled receptors. VIP is produced in many tissues of...
23 KB (2,720 words) - 21:13, 18 May 2024
peptide receptors (FPR) belong to a class of G protein-coupled receptors involved in chemotaxis. In humans, there are three formyl peptide receptor isoforms...
12 KB (1,417 words) - 19:39, 16 September 2024
2006). "Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon receptor antagonist". The Journal of...
25 KB (3,112 words) - 17:33, 17 August 2024
Liraglutide (category Peptide hormones)
outcomes like heart disease and life expectancy are unclear. It is given by injection under the skin. Liraglutide is a glucagon-like peptide-1 receptor agonist...
33 KB (2,855 words) - 21:09, 12 September 2024
Proglucagon (redirect from Glucagon precursors)
OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2, 146–178) Proglucagon...
4 KB (384 words) - 07:05, 2 July 2024
poly-agonist peptides are a class of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs...
8 KB (899 words) - 10:09, 6 August 2024
N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human...
33 KB (4,314 words) - 03:01, 12 August 2024
Secretin receptor family (class B GPCR subfamily) consists of secretin receptors regulated by peptide hormones from the glucagon hormone family. The family...
8 KB (679 words) - 04:13, 25 July 2024
immunoreactivity is PYY3-36, which binds to the Y2 receptor (Y2R) of the Y family of receptors. Peptide YY3-36 (PYY) is a linear polypeptide consisting of...
22 KB (2,673 words) - 12:50, 4 April 2024
melanocortin 1 receptor (MC1R), also known as melanocyte-stimulating hormone receptor (MSHR), melanin-activating peptide receptor, or melanotropin receptor, is a...
33 KB (3,769 words) - 04:57, 6 May 2024
of peptide hormones from pancreatic islets. During development, it stimulates neuronal migration and axon outgrowth. The somatostatin receptor 2 is expressed...
32 KB (4,012 words) - 12:39, 29 August 2024
the enzyme dipeptidyl peptidase-4 (DPP-4). Glucagon-like peptide (GLP) agonists bind to a membrane GLP receptor. As a consequence, insulin release from the...
50 KB (5,222 words) - 18:06, 23 August 2024
antagonists. Oxytocin receptor agonists have also been developed. Peptide Carbetocin Demoxytocin Lipo-oxytocin-1 Merotocin Oxytocin Non-peptide LIT-001 — improved...
22 KB (2,497 words) - 03:15, 29 July 2024
Somatostatin (redirect from Receptors, somatostatin)
protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin inhibits insulin and glucagon secretion. Somatostatin...
23 KB (2,532 words) - 08:06, 21 July 2024