The C-terminus (also known as the carboxyl-terminus, carboxy-terminus, C-terminal tail, carboxy tail, C-terminal end, or COOH-terminus) is the end of an...
5 KB (583 words) - 18:03, 18 April 2024
the C-terminus, and a free amine group on the other end called the N-terminus. By convention, peptide sequences are written N-terminus to C-terminus, left...
7 KB (751 words) - 22:09, 29 July 2024
as the N-terminus or amino terminus, whereas the end of the protein with a free carboxyl group is known as the C-terminus or carboxy terminus (the sequence...
101 KB (11,357 words) - 21:37, 30 July 2024
helicase domain toward the C-terminus. Most parvoviruses contain a transcriptional activation domain near the C-terminus that upregulates transcription...
32 KB (4,019 words) - 20:08, 1 February 2024
covalently bound through its C-terminal carboxylate group to a particular lysine, cysteine, serine, threonine or N-terminus of the target protein. Polyubiquitylation...
98 KB (11,068 words) - 18:53, 17 August 2024
positioned such that their carboxyl-terminus is towards the cytosol, or Type II, which have their amino-terminus towards the cytosol. Type III proteins...
9 KB (1,035 words) - 19:59, 25 January 2024
(usually 16-30 amino acids long) present at the N-terminus (or occasionally nonclassically at the C-terminus or internally) of most newly synthesized proteins...
15 KB (1,749 words) - 23:12, 13 August 2024
1, primarily located in the voltage sensitive S4 segment through the C-terminus. Of these mutations, 5 are nonsense mutations, 13 are missense mutations...
26 KB (2,574 words) - 06:30, 7 August 2024
bond to the C-terminus, but entropically it was more favorable to hydrogen bond with the N-terminus. Specifically, they found that C-terminus hydrogen bonding...
22 KB (3,076 words) - 01:13, 10 August 2024
the C-terminus of the 2A peptide, resulting in the peptide located upstream of the 2A peptide having extra amino acids appended to its C-terminus while...
10 KB (1,126 words) - 21:28, 19 August 2024
consists of at least six histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as a hexa histidine-tag, 6xHis-tag, or...
22 KB (2,655 words) - 07:35, 10 August 2024
glycophosphatidylinositol (GPI) is a phosphoglyceride that can be attached to the C-terminus of a protein during posttranslational modification. The resulting GPI-anchored...
6 KB (656 words) - 16:08, 10 July 2024
Western blotting. The peptide sequence of the FLAG-tag from the N-terminus to the C-terminus is: DYKDDDDK (1012 Da). Additionally, FLAG-tags may be used in...
7 KB (846 words) - 22:41, 10 August 2024
in the opposite order (starting at the C-terminus) to biological protein synthesis (starting at the N-terminus). Protein sequence is typically notated...
21 KB (2,595 words) - 10:30, 22 August 2024
extracellular N-terminus, cytoplasmic C-terminus, whereas ADIPORs are inverted). In terms of structure, GPCRs are characterized by an extracellular N-terminus, followed...
82 KB (9,384 words) - 18:56, 11 June 2024
Chhatrapati Shivaji Terminus (officially Chhatrapati Shivaji Maharaj Terminus since 2017, formerly Victoria Terminus (VT), Bombay station code: CSMT (mainline)/ST...
24 KB (2,182 words) - 04:32, 27 August 2024
used to modify biopolymers, fragment proteins and peptides (cuts the C-terminus of methionine), and synthesize other compounds. The compound is classified...
15 KB (1,520 words) - 13:24, 26 August 2024
threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity...
11 KB (1,228 words) - 17:51, 29 July 2023
C-terminus "polymerase relic" region, despite being unnecessary for polymerase activity, is thought to be essential to cell vitality. The C-terminus region...
59 KB (7,090 words) - 06:49, 30 June 2024
starts at the carboxyl end of the peptide (C-terminus), and proceeds toward the amino-terminus (N-terminus). Protein biosynthesis (long peptides) in living...
54 KB (6,100 words) - 16:21, 3 August 2024
5′-to-3′ direction, and will extend the protein from its N-terminus toward its C-terminus. For example, in a typical gene a start codon (5′-ATG-3′) is...
9 KB (1,191 words) - 13:38, 29 May 2024
of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^...
33 KB (4,044 words) - 20:39, 24 August 2024
that cause a reading shift, which then leads to the formation of a novel C terminus. There are two common types of CALR mutations, type 1 and type 2. Type...
19 KB (2,159 words) - 09:04, 3 July 2024
trafficking cycle are believed to be encoded in the C-terminus. A dileucine motif in the C-terminus is required for VMAT2 endocytosis. Studies suggest...
43 KB (4,990 words) - 08:07, 27 June 2024
the target protein, so they are either C-terminus or N-terminus specific or are both C-terminus and N-terminus specific. Some tags are also inserted at...
24 KB (2,673 words) - 17:55, 22 July 2024
atomic mass and has 10 amino acids. It can be fused to the C-terminus and the N-terminus of a protein. It is advisable not to fuse the myc-tag directly...
2 KB (296 words) - 22:15, 4 April 2024
domain 2 (residues 118–174) is less basic and more hydrophobic and its C-terminus is at the end of p21; domain 3 (residues 175–191) is highly hydrophobic...
54 KB (6,593 words) - 11:14, 31 July 2024
histidines (H180 and H277). Association occurs between the C-terminus of RNR2 and the C-terminus of RNR1. Enzymatic activity is dependent on association...
35 KB (3,620 words) - 09:43, 1 August 2024
found towards the C-terminus. The protein backbone is folded into five α-helices that are numbered α1-α5 from N-terminus to C-terminus. Helices α3, α4 and...
33 KB (3,823 words) - 05:09, 22 July 2024
The CaaX motif is found at the COOH-terminus of proteins, such as lamins or Ras. The motif consists of a cysteine (C), two aliphatic amino acids ("aa")...
15 KB (1,810 words) - 16:46, 26 June 2024