Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and is...
26 KB (2,990 words) - 04:12, 3 December 2024
Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...
29 KB (3,613 words) - 10:59, 23 November 2024
The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors (secretin...
12 KB (1,338 words) - 07:40, 26 October 2024
GLP-1 receptor agonist (redirect from Glucagon-like peptide-1 analog)
Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of anorectic drugs that reduce...
48 KB (5,040 words) - 12:16, 11 December 2024
Glucagon, sold under the brand name Baqsimi among others, is a medication and hormone. As a medication it is used to treat low blood sugar, beta blocker...
26 KB (1,943 words) - 14:26, 28 July 2024
after meals. Glucagon is another hormone involved in regulating blood glucose levels, and can be thought of as the opposite of insulin. Glucagon helps to...
65 KB (6,280 words) - 09:36, 6 December 2024
Alpha cell (redirect from Glucagon-secreting cells)
of Langerhans in the pancreas. Alpha cells secrete the peptide hormone glucagon in order to increase glucose levels in the blood stream. Islets of Langerhans...
38 KB (3,972 words) - 17:31, 30 November 2024
The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...
33 KB (4,123 words) - 20:16, 7 December 2024
mostly to regulate blood sugar levels, secreting the hormones insulin, glucagon, somatostatin and pancreatic polypeptide. As a part of the digestive system...
51 KB (5,754 words) - 14:55, 15 December 2024
for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered...
75 KB (6,396 words) - 13:06, 13 December 2024
Glucagon receptor agonists are a class of drugs under development for the treatment of obesity, non-alcoholic fatty liver disease, and congenital hyperinsulinism...
6 KB (676 words) - 17:59, 5 December 2023
Proglucagon (redirect from Glucagon precursors)
Proglucagon is a protein that is a precursor of glucagon and several other components. It is cleaved from preproglucagon. Proglucagon is generated in the...
4 KB (395 words) - 06:20, 29 November 2024
Diabetic hypoglycemia (section Glucagon)
cause unconsciousness requiring intravenous dextrose or an injection of glucagon. Severe hypoglycemic unconsciousness is one form of diabetic coma. A common...
18 KB (2,288 words) - 20:20, 1 December 2023
Blood sugar regulation (section Glucagon)
referred to as glucose homeostasis. Insulin, which lowers blood sugar, and glucagon, which raises it, are the most well known of the hormones involved, but...
11 KB (923 words) - 21:59, 21 October 2024
sugar to normal levels. Glucagon, another hormone produced by alpha cells, is secreted in response to low blood sugar levels; glucagon stimulates glycogen...
39 KB (4,603 words) - 05:10, 18 December 2024
of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs are developed for the same...
8 KB (899 words) - 10:09, 6 August 2024
Secretin family (redirect from Glucagon hormone family)
Glucagon/gastric inhibitory polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related peptide hormones that regulate...
4 KB (436 words) - 02:40, 3 July 2022
beyond a certain limit. Namely, those counter-regulatory mechanisms are glucagon and epinephrine. The process of the regulation of blood glucose (also known...
23 KB (3,140 words) - 04:34, 15 November 2024
stimulate glucagon upon hypoglycemia prevents a glucagon-mediated rescue of glucose levels. Onset of type 1 diabetes is followed by an increase in glucagon secretion...
118 KB (13,899 words) - 09:33, 13 December 2024
– was approved by the FDA in 2006. Glucagon increases blood glucose levels, and DPP-4 inhibitors reduce glucagon and blood glucose levels. The mechanism...
16 KB (1,801 words) - 20:12, 7 December 2024
Retatrutide (category Glucagon receptor agonists)
American pharmaceutical company Eli Lilly and Company. It is a triple glucagon hormone receptor agonist (GLP-1, GIP, and GCGR receptors). It has been...
4 KB (328 words) - 05:24, 6 August 2024
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...
2 KB (258 words) - 20:23, 20 December 2023
The glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor...
2 KB (133 words) - 10:09, 17 January 2024
disease. The hormone Glucagon-like Peptide 1 can lessen the brain's inflamed reaction caused by amyloid beta oxidative stress. Glucagon-like Peptide 1 can...
25 KB (2,526 words) - 20:21, 31 October 2024
being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as...
9 KB (1,052 words) - 16:12, 2 May 2024
Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R) is...
6 KB (812 words) - 00:33, 10 March 2024
dehydration can cause an increase in counterregulatory hormones such as glucagon, cortisol and growth hormone which may further increase free fatty acid...
12 KB (1,187 words) - 02:17, 6 December 2024
Glucagon rescue is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures and/or unconsciousness by...
10 KB (914 words) - 20:08, 1 December 2023
nausea, diarrhea, vomiting, abdominal pain, and decreased appetite. It is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37)...
16 KB (1,542 words) - 20:53, 21 September 2024
blood-glucose–dependent mechanism. Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition,...
7 KB (885 words) - 09:29, 30 September 2024