• Thumbnail for Glucagon
    Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and is...
    24 KB (2,821 words) - 06:18, 10 July 2024
  • Thumbnail for Glucagon-like peptide-1
    Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...
    26 KB (3,371 words) - 16:42, 17 July 2024
  • Thumbnail for Glucagon receptor
    The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled...
    12 KB (1,419 words) - 04:28, 24 September 2023
  • Thumbnail for Glucagon-like peptide-1 receptor
    The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...
    33 KB (4,070 words) - 19:12, 15 May 2024
  • Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of drugs that reduce blood sugar...
    36 KB (4,057 words) - 03:10, 15 July 2024
  • Thumbnail for Glucagon (medication)
    Glucagon, sold under the brand name Baqsimi among others, is a medication and hormone. As a medication it is used to treat low blood sugar, beta blocker...
    25 KB (1,928 words) - 02:40, 16 July 2024
  • Thumbnail for Hypoglycemia
    after meals. Glucagon is another hormone involved in regulating blood glucose levels, and can be thought of as the opposite of insulin. Glucagon helps to...
    63 KB (6,112 words) - 21:47, 19 July 2024
  • Thumbnail for Semaglutide
    for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered...
    66 KB (5,376 words) - 05:15, 23 July 2024
  • Thumbnail for Pancreas
    mostly to regulate blood sugar levels, secreting the hormones insulin, glucagon, somatostatin and pancreatic polypeptide. As a part of the digestive system...
    50 KB (5,610 words) - 15:05, 2 July 2024
  • Thumbnail for Alpha cell
    of Langerhans in the pancreas. Alpha cells secrete the peptide hormone glucagon in order to increase glucose levels in the blood stream. Islets of Langerhans...
    38 KB (3,972 words) - 06:49, 3 March 2024
  • Thumbnail for Type 1 diabetes
    stimulate glucagon upon hypoglycemia prevents a glucagon-mediated rescue of glucose levels. Onset of type 1 diabetes is followed by an increase in glucagon secretion...
    95 KB (10,828 words) - 11:19, 16 July 2024
  • Thumbnail for Dipeptidyl peptidase-4 inhibitor
    – was approved by the FDA in 2006. Glucagon increases blood glucose levels, and DPP-4 inhibitors reduce glucagon and blood glucose levels. The mechanism...
    16 KB (1,798 words) - 07:40, 1 February 2024
  • Thumbnail for Proglucagon
    Oxyntomodulin (OXY or OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2,...
    4 KB (384 words) - 07:05, 2 July 2024
  • of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs are developed for the same...
    8 KB (898 words) - 18:41, 8 June 2024
  • Glucagon receptor agonists are a class of drugs under development for the treatment of obesity, non-alcoholic fatty liver disease, and congenital hyperinsulinism...
    6 KB (676 words) - 17:59, 5 December 2023
  • Thumbnail for Endocrine system
    sugar to normal levels. Glucagon, another hormone produced by alpha cells, is secreted in response to low blood sugar levels; glucagon stimulates glycogen...
    39 KB (4,602 words) - 12:35, 13 July 2024
  • Thumbnail for Blood sugar regulation
    referred to as glucose homeostasis. Insulin, which lowers blood sugar, and glucagon, which raises it, are the most well known of the hormones involved, but...
    11 KB (923 words) - 17:44, 18 January 2024
  • Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...
    2 KB (258 words) - 20:23, 20 December 2023
  • Thumbnail for Secretin family
    Glucagon/gastric inhibitory polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related peptide hormones that regulate...
    4 KB (436 words) - 02:40, 3 July 2022
  • Thumbnail for Glucagon-like peptide-2 receptor
    Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R) is...
    6 KB (812 words) - 00:33, 10 March 2024
  • The glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide 1 receptor (GLP-1R) – binds glucagon-like peptide...
    367 bytes (75 words) - 11:23, 22 February 2024
  • Thumbnail for Type 3 diabetes
    disease. The hormone Glucagon-like Peptide 1 can lessen the brain's inflamed reaction caused by amyloid beta oxidative stress. Glucagon-like Peptide 1 can...
    25 KB (2,525 words) - 01:56, 12 July 2024
  • Thumbnail for Glucagon rescue
    Glucagon rescue is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures and/or unconsciousness by...
    10 KB (914 words) - 20:08, 1 December 2023
  • Thumbnail for Incretin
    blood-glucose–dependent mechanism. Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition,...
    7 KB (757 words) - 23:21, 3 March 2024
  • University. Her research considers peptide synthesis. She discovered the glucagon-like peptide-1 and uncovered its role in glucose metabolism and the secretion...
    11 KB (1,159 words) - 19:20, 1 July 2024
  • Thumbnail for Diabetic hypoglycemia
    cause unconsciousness requiring intravenous dextrose or an injection of glucagon. Severe hypoglycemic unconsciousness is one form of diabetic coma. A common...
    18 KB (2,288 words) - 20:20, 1 December 2023
  • Thumbnail for Dulaglutide
    nausea, diarrhea, vomiting, abdominal pain, and decreased appetite. It is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37)...
    16 KB (1,511 words) - 23:59, 19 July 2024
  • beyond a certain limit. Namely, those counter-regulatory mechanisms are glucagon and epinephrine. The process of the regulation of blood glucose (also known...
    23 KB (3,157 words) - 01:15, 3 April 2024
  • Thumbnail for Gastric inhibitory polypeptide
    being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as...
    9 KB (1,052 words) - 16:12, 2 May 2024
  • Thumbnail for Danuglipron
    Loria PM, et al. (June 2022). "A Small-Molecule Oral Agonist of the Human Glucagon-like Peptide-1 Receptor". Journal of Medicinal Chemistry. 65 (12): 8208–8226...
    5 KB (193 words) - 07:27, 15 June 2024