The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...

Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R)...

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...

the action of GLP-1 is preserved in patients with type 2 diabetes. Glucagon-like peptide-1 receptor agonists gained approval as drugs to treat diabetes and...

The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to...

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of anorectic drugs that reduce...

glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide-1 receptor (GLP-1R) – binds Glucagon-like peptide-1...

Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...

glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like...

type 2 diabetes and an anti-obesity medication used for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1)...

natriuretic peptide (ANP) Calcitonin Cholecystokinin (CCK) Gastrin Ghrelin Glucagon Glucose-dependent insulinotropic polypeptide (GIP) Glucagon-like peptide-1 (GLP-1)...

family peptide receptor 2 (RXFP2, GPR106) Relaxin/insulin-like family peptide receptor 3 (RXFP3, SALPR) Relaxin/insulin-like family peptide receptor 4 (RXFP4...

an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins...

weight loss. Tirzepatide is a gastric inhibitory polypeptide receptor and glucagon-like peptide-1 agonist. The most common side effects include nausea, vomiting...

peptide receptors (FPR) belong to a class of G protein-coupled receptors involved in chemotaxis. In humans, there are three formyl peptide receptor isoforms...

Signaling peptide receptor is a type of receptor which binds one or more signaling peptides or signaling proteins. An example is the tropomyosin receptor kinase...

recognized to be the principal physiologic action of GIP. Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after...

2006). "Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon receptor antagonist". The Journal of...

amino acid residues that belongs to a glucagon/secretin superfamily, the ligand of class II G protein–coupled receptors. VIP is produced in many tissues of...

immunoreactivity is PYY3-36, which binds to the Y2 receptor (Y2R) of the Y family of receptors. Peptide YY3-36 (PYY) is a linear polypeptide consisting of...

outcomes like heart disease and life expectancy are unclear. It is given by injection under the skin. Liraglutide is a glucagon-like peptide-1 receptor agonist...

Secretin receptor family (class B GPCR subfamily) consists of secretin receptors regulated by peptide hormones from the glucagon hormone family. The family...

OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2, 146–178) Proglucagon...

N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human...

melanocortin 1 receptor (MC1R), also known as melanocyte-stimulating hormone receptor (MSHR), melanin-activating peptide receptor, or melanotropin receptor, is a...

poly-agonist peptides are a class of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs...

the enzyme dipeptidyl peptidase-4 (DPP-4). Glucagon-like peptide (GLP) agonists bind to a membrane GLP receptor. As a consequence, insulin release from the...

protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin inhibits insulin and glucagon secretion. Somatostatin...

of peptide hormones from pancreatic islets. During development, it stimulates neuronal migration and axon outgrowth. The somatostatin receptor 2 is expressed...

antagonists. Oxytocin receptor agonists have also been developed. Peptide Carbetocin Demoxytocin Lipo-oxytocin-1 Merotocin Oxytocin Non-peptide LIT-001 — improved...