The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...
33 KB (4,119 words) - 22:32, 11 October 2024
Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R)...
6 KB (812 words) - 00:33, 10 March 2024
the action of GLP-1 is preserved in patients with type 2 diabetes. Glucagon-like peptide-1 receptor agonists gained approval as drugs to treat diabetes and...
28 KB (3,558 words) - 20:41, 16 October 2024
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...
2 KB (258 words) - 20:23, 20 December 2023
The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to...
12 KB (1,335 words) - 05:49, 17 August 2024
Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of anorectic drugs that reduce...
42 KB (4,486 words) - 01:45, 19 October 2024
glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide-1 receptor (GLP-1R) – binds Glucagon-like peptide-1...
367 bytes (75 words) - 20:07, 20 August 2024
Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...
26 KB (2,990 words) - 21:58, 16 October 2024
glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like...
2 KB (133 words) - 10:09, 17 January 2024
Semaglutide (category Peptide therapeutics)
type 2 diabetes and an anti-obesity medication used for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1)...
68 KB (5,684 words) - 04:12, 20 October 2024
family peptide receptor 2 (RXFP2, GPR106) Relaxin/insulin-like family peptide receptor 3 (RXFP3, SALPR) Relaxin/insulin-like family peptide receptor 4 (RXFP4...
25 KB (2,172 words) - 01:01, 29 November 2023
natriuretic peptide (ANP) Calcitonin Cholecystokinin (CCK) Gastrin Ghrelin Glucagon Glucose-dependent insulinotropic polypeptide (GIP) Glucagon-like peptide-1 (GLP-1)...
5 KB (547 words) - 00:01, 22 August 2024
Gastric inhibitory polypeptide (redirect from Gastrointestinal inhibitory peptide)
an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins...
9 KB (1,052 words) - 16:12, 2 May 2024
recognized to be the principal physiologic action of GIP. Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after...
11 KB (1,186 words) - 21:23, 16 April 2024
amino acid residues that belongs to a glucagon/secretin superfamily, the ligand of class II G protein–coupled receptors. VIP is produced in many tissues of...
23 KB (2,720 words) - 21:13, 18 May 2024
peptide receptors (FPR) belong to a class of G protein-coupled receptors involved in chemotaxis. In humans, there are three formyl peptide receptor isoforms...
12 KB (1,417 words) - 19:39, 16 September 2024
Signaling peptide receptor is a type of receptor which binds one or more signaling peptides or signaling proteins. An example is the tropomyosin receptor kinase...
13 KB (706 words) - 20:05, 20 August 2024
Proglucagon (redirect from Glucagon precursors)
OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2, 146–178) Proglucagon...
4 KB (384 words) - 07:05, 2 July 2024
The alpha-2 (α2) adrenergic receptor (or adrenoceptor) is a G protein-coupled receptor (GPCR) associated with the Gi heterotrimeric G-protein. It consists...
25 KB (2,231 words) - 17:54, 18 September 2024
melanocortin 1 receptor (MC1R), also known as melanocyte-stimulating hormone receptor (MSHR), melanin-activating peptide receptor, or melanotropin receptor, is a...
33 KB (3,769 words) - 04:57, 6 May 2024
Somatostatin (redirect from Receptors, somatostatin)
protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin inhibits insulin and glucagon secretion. Somatostatin...
23 KB (2,532 words) - 08:06, 21 July 2024
poly-agonist peptides are a class of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs...
8 KB (899 words) - 10:09, 6 August 2024
Liraglutide (category Peptide hormones)
outcomes like heart disease and life expectancy are unclear. It is given by injection under the skin. Liraglutide is a glucagon-like peptide-1 receptor agonist...
33 KB (2,859 words) - 07:55, 30 September 2024
natriuretic peptide receptors: natriuretic peptide receptor A (NPR-A), Natriuretic Peptide Receptor-B (NPR-B), and Natriuretic Peptide Receptor-C (NPR-C)...
15 KB (1,731 words) - 00:47, 18 September 2024
immunoreactivity is PYY3-36, which binds to the Y2 receptor (Y2R) of the Y family of receptors. Peptide YY3-36 (PYY) is a linear polypeptide consisting of...
22 KB (2,673 words) - 12:50, 4 April 2024
N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human...
33 KB (4,314 words) - 03:01, 12 August 2024
dynorphins. They are also referred to as μ(mu)-opioid peptide (MOP) receptors. The prototypical μ-opioid receptor agonist is morphine, the primary psychoactive...
49 KB (4,885 words) - 11:31, 6 October 2024
Parathyroid hormone/parathyroid hormone-related peptide receptor, also known as parathyroid hormone 1 receptor (PTH1R), is a protein that in humans is encoded...
14 KB (1,597 words) - 11:15, 31 July 2024
the atrial natriuretic factor receptor NPRA, and to a lesser extent NPRB, in a fashion similar to atrial natriuretic peptide (ANP) but with 10-fold lower...
39 KB (4,470 words) - 19:49, 15 October 2024
and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions from lacrimal glands. Receptor also...
33 KB (3,418 words) - 06:46, 20 October 2024