Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and is...

Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...

The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled...

Glucagon, sold under the brand name Baqsimi among others, is a medication and hormone. As a medication it is used to treat low blood sugar, beta blocker...

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of drugs that reduce blood sugar...

The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...

of Langerhans in the pancreas. Alpha cells secrete the peptide hormone glucagon in order to increase glucose levels in the blood stream. Islets of Langerhans...

mostly to regulate blood sugar levels, secreting the hormones insulin, glucagon, somatostatin and pancreatic polypeptide. As a part of the digestive system...

for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered...

after meals. Glucagon is another hormone involved in regulating blood glucose levels, and can be thought of as the opposite of insulin. Glucagon helps to...

Oxyntomodulin (OXY or OXM, 53–89) Glucagon (53–81) Glucagon-like peptide 1 (GLP-1, 92–128) – first seven residues further cleaved Glucagon-like peptide 2 (GLP-2,...

– was approved by the FDA in 2006. Glucagon increases blood glucose levels, and DPP-4 inhibitors reduce glucagon and blood glucose levels. The mechanism...

stimulate glucagon upon hypoglycemia prevents a glucagon-mediated rescue of glucose levels. Onset of type 1 diabetes is followed by an increase in glucagon secretion...

Glucagon receptor agonists are a class of drugs under development for the treatment of obesity, non-alcoholic fatty liver disease, and congenital hyperinsulinism...

sugar to normal levels. Glucagon, another hormone produced by alpha cells, is secreted in response to low blood sugar levels; glucagon stimulates glycogen...

referred to as glucose homeostasis. Insulin, which lowers blood sugar, and glucagon, which raises it, are the most well known of the hormones involved, but...

of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs are developed for the same...

Glucagon/gastric inhibitory polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related peptide hormones that regulate...

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...

being an incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as...

Glucagon rescue is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures and/or unconsciousness by...

cause unconsciousness requiring intravenous dextrose or an injection of glucagon. Severe hypoglycemic unconsciousness is one form of diabetic coma. A common...

disease. The hormone Glucagon-like Peptide 1 can lessen the brain's inflamed reaction caused by amyloid beta oxidative stress. Glucagon-like Peptide 1 can...

Loria PM, et al. (June 2022). "A Small-Molecule Oral Agonist of the Human Glucagon-like Peptide-1 Receptor". Journal of Medicinal Chemistry. 65 (12): 8208–8226...

nausea, diarrhea, vomiting, abdominal pain, and decreased appetite. It is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37)...

Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R) is...

Lotiglipron is a non-peptide glucagon-like peptide-1 receptor agonist developed as a weight loss drug by Pfizer. It was withdrawn from development after...

blood-glucose–dependent mechanism. Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition,...

The glucagon receptor family is a group of closely related G-protein coupled receptors which include: Glucagon receptor Glucagon-like peptide 1 receptor...

beyond a certain limit. Namely, those counter-regulatory mechanisms are glucagon and epinephrine. The process of the regulation of blood glucose (also known...